Reaction Details |
| Report a problem with these data |
Target | Stimulator of interferon genes protein |
---|
Ligand | BDBM50604555 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2248221 (CHEMBL5162431) |
---|
IC50 | 2.9±n/a nM |
---|
Citation | Chang, W; Altman, MD; Lesburg, CA; Perera, SA; Piesvaux, JA; Schroeder, GK; Wyss, DF; Cemerski, S; Chen, Y; DiNunzio, E; Haidle, AM; Ho, T; Kariv, I; Knemeyer, I; Kopinja, JE; Lacey, BM; Laskey, J; Lim, J; Long, BJ; Ma, Y; Maddess, ML; Pan, BS; Presland, JP; Spooner, E; Steinhuebel, D; Truong, Q; Zhang, Z; Fu, J; Addona, GH; Northrup, AB; Parmee, E; Tata, JR; Bennett, DJ; Cumming, JN; Siu, T; Trotter, BW Discovery of MK-1454: A Potent Cyclic Dinucleotide Stimulator of Interferon Genes Agonist for the Treatment of Cancer. J Med Chem65:5675-5689 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Stimulator of interferon genes protein |
---|
Name: | Stimulator of interferon genes protein |
Synonyms: | ERIS | Endoplasmic reticulum interferon stimulator | MITA | Mediator of IRF3 activation | STING | STING1 | STING_HUMAN | Synonyms=ERIS | TMEM173 | Transmembrane protein 173 | hMITA | hSTING |
Type: | Protein |
Mol. Mass.: | 42195.64 |
Organism: | Human |
Description: | Q86WV6 |
Residue: | 379 |
Sequence: | MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
|
|
|
BDBM50604555 |
---|
n/a |
---|
Name | BDBM50604555 |
Synonyms: | CHEMBL5181746 |
Type | Small organic molecule |
Emp. Form. | C21H30N12O13P2 |
Mol. Mass. | 720.483 |
SMILES | N.N.[H][C@@]12COP(O)(=O)O[C@@]3([H])[C@@]4([H])OC[C@]3(COP(O)(=O)O[C@]([H])([C@@H]1O)[C@@H](O2)n1cnc2c1nc(N)[nH]c2=O)O[C@H]4n1cnc2c(N)ncnc12 |r,TLB:9:10:40.41:14.15| |
Structure |
|