| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Stimulator of interferon genes protein |
|---|
| Ligand | BDBM50604563 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2248221 (CHEMBL5162431) |
|---|
| IC50 | 1.9±n/a nM |
|---|
| Citation |  Chang, W; Altman, MD; Lesburg, CA; Perera, SA; Piesvaux, JA; Schroeder, GK; Wyss, DF; Cemerski, S; Chen, Y; DiNunzio, E; Haidle, AM; Ho, T; Kariv, I; Knemeyer, I; Kopinja, JE; Lacey, BM; Laskey, J; Lim, J; Long, BJ; Ma, Y; Maddess, ML; Pan, BS; Presland, JP; Spooner, E; Steinhuebel, D; Truong, Q; Zhang, Z; Fu, J; Addona, GH; Northrup, AB; Parmee, E; Tata, JR; Bennett, DJ; Cumming, JN; Siu, T; Trotter, BW Discovery of MK-1454: A Potent Cyclic Dinucleotide Stimulator of Interferon Genes Agonist for the Treatment of Cancer. J Med Chem65:5675-5689 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Stimulator of interferon genes protein |
|---|
| Name: | Stimulator of interferon genes protein |
|---|
| Synonyms: | ERIS | Endoplasmic reticulum interferon stimulator | MITA | Mediator of IRF3 activation | STING | STING1 | STING_HUMAN | Synonyms=ERIS | TMEM173 | Transmembrane protein 173 | hMITA | hSTING |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 42195.64 |
|---|
| Organism: | Human |
|---|
| Description: | Q86WV6 |
|---|
| Residue: | 379 |
|---|
| Sequence: | MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
|
|
|
|---|
| BDBM50604563 |
|---|
| n/a |
|---|
| Name | BDBM50604563 |
|---|
| Synonyms: | CHEMBL5201164 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H30N12O11P2S2 |
|---|
| Mol. Mass. | 752.614 |
|---|
| SMILES | N.N.[H][C@@]12CO[P@](S)(=O)O[C@@]3([H])[C@@]4([H])OC[C@]3(CO[P@](S)(=O)O[C@]([H])([C@@H]1O)[C@@H](O2)n1cnc2c1nc(N)[nH]c2=O)O[C@H]4n1cnc2c(N)ncnc12 |r,TLB:9:10:40.41:14.15| |
|---|
| Structure | 
|
|---|
Search and Browse
