| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Substance-P receptor |
|---|
| Ligand | BDBM50290859 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_143042 |
|---|
| IC50 | 0.160000±n/a nM |
|---|
| Citation |  Swain, CJ; Williams, BJ; Baker, R; Cascieri, MA; Chicchi, G; Forrest, M; Herbert, R; Keown, L; Ladduwahetty, T; Luell, S; MacIntyre, DE; Metzger, J; Morton, S; Owens, AP; Sadowski, S; Watt, AP 3-Benzyloxy-2-phenylpiperidine NK1 antagonists: the influence of alpha methyl substitution Bioorg Med Chem Lett7:2959-2962 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Substance-P receptor |
|---|
| Name: | Substance-P receptor |
|---|
| Synonyms: | NK-1 receptor | NK-1R | NK1 Receptor | NK1R_RAT | Neurokinin 1 receptor | Neurokinin NK1 | SPR | Substance-P receptor | Tac1r | Tachykinin receptor 1 | Tacr1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 46371.54 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected CHO cells that constitutively expressed the rat NK1 receptor. |
|---|
| Residue: | 407 |
|---|
| Sequence: | MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
|
|
|
|---|
| BDBM50290859 |
|---|
| n/a |
|---|
| Name | BDBM50290859 |
|---|
| Synonyms: | 5-{3-[1-(3,5-Bis-trifluoromethyl-phenyl)-ethoxy]-2-phenyl-piperidin-1-ylmethyl}-2,4-dihydro-[1,2,4]triazol-3-one | CHEMBL98524 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24F6N4O2 |
|---|
| Mol. Mass. | 514.4634 |
|---|
| SMILES | C[C@@H](O[C@H]1CCCN(Cc2n[nH]c(=O)[nH]2)[C@H]1c1ccccc1)c1cc(cc(c1)C(F)(F)F)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
