Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 1 |
---|
Ligand | BDBM50386864 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_828467 (CHEMBL2049904) |
---|
EC50 | 0.61±n/a nM |
---|
Citation | Buzard, DJ; Han, S; Lopez, L; Kawasaki, A; Moody, J; Thoresen, L; Ullman, B; Lehmann, J; Calderon, I; Zhu, X; Gharbaoui, T; Sengupta, D; Krishnan, A; Gao, Y; Edwards, J; Barden, J; Morgan, M; Usmani, K; Chen, C; Sadeque, A; Thatte, J; Solomon, M; Fu, L; Whelan, K; Liu, L; Al-Shamma, H; Gatlin, J; Le, M; Xing, C; Espinola, S; Jones, RM Fused tricyclic indoles as S1P1 agonists with robust efficacy in animal models of autoimmune disease. Bioorg Med Chem Lett22:4404-9 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 1 |
---|
Name: | Sphingosine 1-phosphate receptor 1 |
Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
Type: | Enzyme |
Mol. Mass.: | 42836.02 |
Organism: | Homo sapiens (Human) |
Description: | P21453 |
Residue: | 382 |
Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
BDBM50386864 |
---|
n/a |
---|
Name | BDBM50386864 |
Synonyms: | CHEMBL2048298 |
Type | Small organic molecule |
Emp. Form. | C25H22N4O4 |
Mol. Mass. | 442.4666 |
SMILES | CC(C)Oc1ccc(cc1C#N)-c1nc(no1)-c1ccc2n3CCC(CC(O)=O)c3cc2c1 |
Structure |
|