Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM50386859 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_828468 (CHEMBL2049905) |
---|
EC50 | >100000±n/a nM |
---|
Citation | Buzard, DJ; Han, S; Lopez, L; Kawasaki, A; Moody, J; Thoresen, L; Ullman, B; Lehmann, J; Calderon, I; Zhu, X; Gharbaoui, T; Sengupta, D; Krishnan, A; Gao, Y; Edwards, J; Barden, J; Morgan, M; Usmani, K; Chen, C; Sadeque, A; Thatte, J; Solomon, M; Fu, L; Whelan, K; Liu, L; Al-Shamma, H; Gatlin, J; Le, M; Xing, C; Espinola, S; Jones, RM Fused tricyclic indoles as S1P1 agonists with robust efficacy in animal models of autoimmune disease. Bioorg Med Chem Lett22:4404-9 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM50386859 |
---|
n/a |
---|
Name | BDBM50386859 |
Synonyms: | CHEMBL2048293 |
Type | Small organic molecule |
Emp. Form. | C23H15F3N4O4 |
Mol. Mass. | 468.3848 |
SMILES | OC(=O)CC1CCn2c1cc1cc(ccc21)-c1noc(n1)-c1cc(OC(F)(F)F)cc(c1)C#N |
Structure |
|