Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR3
LigandBDBM50400524
Substrate/Competitorn/a
Meas. Tech.ChEMBL_879796
IC50 0.460000±n/a nM
Citation He SYe ZTruong QShah SDu WGuo LDobbelaar PHLai ZLiu JJian TQi HBakshi RKHong QDellureficio JPasternak AFeng ZdeJesus RYang LReibarkh MBradley SAHolmes MABall RGRuck RTHuffman MAWong FSamuel KReddy VBMitelman STong SXChicchi GGTsao KLTrusca DWu MShao QTrujillo MEEiermann GJLi CZhang BBHoward ADZhou YPNargund RPHagmann WK The Discovery of MK-4256, a Potent SSTR3 Antagonist as a Potential Treatment of Type 2 Diabetes. ACS Med Chem Lett 3:484-489 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SSTR3
Name:SSTR3
Synonyms:SOMATOSTATIN SST3 | SS3R | SSR-28 | Somatostatin receptor | Somatostatin receptor 3 | Somatostatin receptor type 3
Type:Enzyme Catalytic Domain
Mol. Mass.:47225.49
Organism:MOUSE
Description:SOMATOSTATIN SST3 SSTR3 MOUSE::P30935
Residue:428
Sequence:
MATVTYPSSEPTTLDPGNASSTWPLDTTLGNTSAGASLTGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRIRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQAGTSGQQPRPCTGTAKEQQLLPQEATAGD
KASTLSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50400524
n/a
NameBDBM50400524
Synonyms:CHEMBL2204939
TypeSmall organic molecule
Emp. Form.C28H25FN8
Mol. Mass.492.5501
SMILESCn1cc(cn1)C1(N[C@H](Cc2c1[nH]c1ccccc21)c1nc(c[nH]1)-c1ccc(F)cc1)c1cnn(C)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: