Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 3
LigandBDBM50400525
Substrate/Competitorn/a
Meas. Tech.ChEMBL_879798
IC50 0.940000±n/a nM
Citation He SYe ZTruong QShah SDu WGuo LDobbelaar PHLai ZLiu JJian TQi HBakshi RKHong QDellureficio JPasternak AFeng ZdeJesus RYang LReibarkh MBradley SAHolmes MABall RGRuck RTHuffman MAWong FSamuel KReddy VBMitelman STong SXChicchi GGTsao KLTrusca DWu MShao QTrujillo MEEiermann GJLi CZhang BBHoward ADZhou YPNargund RPHagmann WK The Discovery of MK-4256, a Potent SSTR3 Antagonist as a Potential Treatment of Type 2 Diabetes. ACS Med Chem Lett 3:484-489 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 3
Name:Somatostatin receptor type 3
Synonyms:SOMATOSTATIN SST3 | SS-3-R | SS3-R | SS3R | SSR-28 | SSTR3 | Somatostatin receptor type 3 (SSTR3)
Type:Protein
Mol. Mass.:45855.97
Organism:Homo sapiens (Human)
Description:P32745
Residue:418
Sequence:
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM
AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV
FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV
WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE
SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50400525
n/a
NameBDBM50400525
Synonyms:CHEMBL2204938
TypeSmall organic molecule
Emp. Form.C27H23FN8O
Mol. Mass.494.5229
SMILESCc1nc(no1)[C@@]1(N[C@@H](Cc2c1[nH]c1ccccc21)c1nc(c[nH]1)-c1ccc(F)cc1)c1cnn(C)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: