| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-C chemokine receptor type 5 |
|---|
| Ligand | BDBM50412737 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_539133 (CHEMBL1023810) |
|---|
| IC50 | 7.24±n/a nM |
|---|
| Citation |  Kazmierski, WM; Aquino, C; Chauder, BA; Deanda, F; Ferris, R; Jones-Hertzog, DK; Kenakin, T; Koble, CS; Watson, C; Wheelan, P; Yang, H; Youngman, M Discovery of bioavailable 4,4-disubstituted piperidines as potent ligands of the chemokine receptor 5 and inhibitors of the human immunodeficiency virus-1. J Med Chem51:6538-46 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-C chemokine receptor type 5 |
|---|
| Name: | C-C chemokine receptor type 5 |
|---|
| Synonyms: | C-C CKR-5 | C-C chemokine receptor type 5 | CC-CKR-5 | CCR-5 | CCR5 | CCR5/mu opioid receptor complex | CCR5_HUMAN | CD_antigen=CD195 | CHEMR13 | CMKBR5 | HIV-1 fusion coreceptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40540.21 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P51681 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
|
|
|
|---|
| BDBM50412737 |
|---|
| n/a |
|---|
| Name | BDBM50412737 |
|---|
| Synonyms: | CHEMBL501085 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H42Cl2N4O |
|---|
| Mol. Mass. | 581.619 |
|---|
| SMILES | Cc1nc2ccccc2n1C1C[C@H]2CC[C@H](C1)N2CCC1(CCN(CC1)C(=O)C(C)(C)C)c1ccc(Cl)c(Cl)c1 |r,TLB:9:10:17:13.14,THB:18:17:10.11.16:13.14| |
|---|
| Structure | 
|
|---|
Search and Browse
