| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Ligand | BDBM50112356 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1513402 (CHEMBL3611557) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  He, R; Yu, ZH; Zhang, RY; Wu, L; Gunawan, AM; Lane, BS; Shim, JS; Zeng, LF; He, Y; Chen, L; Wells, CD; Liu, JO; Zhang, ZY Exploring the Existing Drug Space for Novel pTyr Mimetic and SHP2 Inhibitors. ACS Med Chem Lett6:782-6 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40530.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35236 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
|---|
| BDBM50112356 |
|---|
| n/a |
|---|
| Name | BDBM50112356 |
|---|
| Synonyms: | CHEMBL3609373 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18IN3O6S |
|---|
| Mol. Mass. | 579.364 |
|---|
| SMILES | OS(=O)(=O)C(C(=O)Nc1ccc(NC(=O)C(=O)Nc2ccc(I)cc2)cc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
