Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein phosphatase non-receptor type 7 |
---|
Ligand | BDBM50420258 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1513402 (CHEMBL3611557) |
---|
IC50 | 250000±n/a nM |
---|
Citation | He, R; Yu, ZH; Zhang, RY; Wu, L; Gunawan, AM; Lane, BS; Shim, JS; Zeng, LF; He, Y; Chen, L; Wells, CD; Liu, JO; Zhang, ZY Exploring the Existing Drug Space for Novel pTyr Mimetic and SHP2 Inhibitors. ACS Med Chem Lett6:782-6 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tyrosine-protein phosphatase non-receptor type 7 |
---|
Name: | Tyrosine-protein phosphatase non-receptor type 7 |
Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
Type: | Protein |
Mol. Mass.: | 40530.79 |
Organism: | Homo sapiens (Human) |
Description: | P35236 |
Residue: | 360 |
Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
BDBM50420258 |
---|
n/a |
---|
Name | BDBM50420258 |
Synonyms: | CEFSULODIN |
Type | Small organic molecule |
Emp. Form. | C22H21N4O8S2 |
Mol. Mass. | 533.554 |
SMILES | NC(=O)c1cc[n+](CC2=C(N3[C@H](SC2)[C@H](NC(=O)C(c2ccccc2)S(O)(=O)=O)C3=O)C(O)=O)cc1 |t:8| |
Structure |
|