Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50177010
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1581656
IC50 0.600000±n/a nM
Citation Zheng YZhuang LFan KYTice CMZhao WDong CLotesta SDLeftheris KLindblom PRLiu ZShimada JNoto PBMeng SHardy AHoward LKrosky PGuo JLipinski KKandpal GBukhtiyarov YZhao YLala DVan Orden RZhou JChen GWu ZMcKeever BMMcGeehan GMGregg REClaremon DASingh SB Discovery of a Novel, Orally Efficacious Liver X Receptor (LXR) Agonist. J Med Chem 59:3264-71 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Oxysterols receptor LXR-beta
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177010
n/a
NameBDBM50177010
Synonyms:CHEMBL3814006
TypeSmall organic molecule
Emp. Form.C27H24F3NO5S3
Mol. Mass.595.673
SMILESCS(=O)(=O)c1cc(ccc1CO)-c1ccc(CN(Cc2ccccc2)S(=O)(=O)c2ccccc2C(F)(F)F)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: