Found 59 hits Enz. Inhib. hit(s) with all data for entry = 50043471 Target/Host (Institution) | Ligand | Target/Host Links | Ligand Links | Trg + Lig Links | Ki nM | ΔG° kJ/mole | IC50 nM | Kd nM | EC50/IC50 nM | koff s-1 | kon M-1s-1 | pH | Temp °C |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441574
![PNG](/data/jpeg/tenK5044/BindingDB_50441574.png) (CHEMBL2437163)Show InChI InChI=1S/C19H28ClN3O2S/c20-16-9-11-17(12-10-16)25-14-18(24)22-23-19(26)21-13-5-4-8-15-6-2-1-3-7-15/h9-12,15H,1-8,13-14H2,(H,22,24)(H2,21,23,26) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 170 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441587
![PNG](/data/jpeg/tenK5044/BindingDB_50441587.png) (CHEMBL2437157)Show SMILES O=C(Cc1ccc(cc1)-c1ccccc1)NNC(=S)NCCCCC1CCCCC1 Show InChI InChI=1S/C25H33N3OS/c29-24(19-21-14-16-23(17-15-21)22-12-5-2-6-13-22)27-28-25(30)26-18-8-7-11-20-9-3-1-4-10-20/h2,5-6,12-17,20H,1,3-4,7-11,18-19H2,(H,27,29)(H2,26,28,30) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 300 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441598
![PNG](/data/jpeg/tenK5044/BindingDB_50441598.png) (CHEMBL2437156)Show SMILES O=C(Cc1nc(no1)-c1ccccc1)NNC(=S)NCCCCC1CCCCC1 Show InChI InChI=1S/C21H29N5O2S/c27-18(15-19-23-20(26-28-19)17-12-5-2-6-13-17)24-25-21(29)22-14-8-7-11-16-9-3-1-4-10-16/h2,5-6,12-13,16H,1,3-4,7-11,14-15H2,(H,24,27)(H2,22,25,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 340 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441592
![PNG](/data/jpeg/tenK5044/BindingDB_50441592.png) (CHEMBL2437170)Show SMILES Clc1ccc(OCC(=O)NNC(=S)NCc2ccccc2-c2ccccc2)cc1 Show InChI InChI=1S/C22H20ClN3O2S/c23-18-10-12-19(13-11-18)28-15-21(27)25-26-22(29)24-14-17-8-4-5-9-20(17)16-6-2-1-3-7-16/h1-13H,14-15H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 490 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441590
![PNG](/data/jpeg/tenK5044/BindingDB_50441590.png) (CHEMBL2437164)Show SMILES FC(F)(F)c1ccc(OCC(=O)NNC(=S)NCCCCC2CCCCC2)cc1 Show InChI InChI=1S/C20H28F3N3O2S/c21-20(22,23)16-9-11-17(12-10-16)28-14-18(27)25-26-19(29)24-13-5-4-8-15-6-2-1-3-7-15/h9-12,15H,1-8,13-14H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 540 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441590
![PNG](/data/jpeg/tenK5044/BindingDB_50441590.png) (CHEMBL2437164)Show SMILES FC(F)(F)c1ccc(OCC(=O)NNC(=S)NCCCCC2CCCCC2)cc1 Show InChI InChI=1S/C20H28F3N3O2S/c21-20(22,23)16-9-11-17(12-10-16)28-14-18(27)25-26-19(29)24-13-5-4-8-15-6-2-1-3-7-15/h9-12,15H,1-8,13-14H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 610 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441574
![PNG](/data/jpeg/tenK5044/BindingDB_50441574.png) (CHEMBL2437163)Show InChI InChI=1S/C19H28ClN3O2S/c20-16-9-11-17(12-10-16)25-14-18(24)22-23-19(26)21-13-5-4-8-15-6-2-1-3-7-15/h9-12,15H,1-8,13-14H2,(H,22,24)(H2,21,23,26) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 630 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441586
![PNG](/data/jpeg/tenK5044/BindingDB_50441586.png) (CHEMBL2437153)Show InChI InChI=1S/C18H26ClN3OS/c19-16-11-9-15(10-12-16)17(23)21-22-18(24)20-13-5-4-8-14-6-2-1-3-7-14/h9-12,14H,1-8,13H2,(H,21,23)(H2,20,22,24) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 670 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441593
![PNG](/data/jpeg/tenK5044/BindingDB_50441593.png) (CHEMBL2437173)Show SMILES Clc1ccc(cc1)C(=O)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C21H18ClN3OS/c22-19-12-10-18(11-13-19)20(26)24-25-21(27)23-14-15-6-8-17(9-7-15)16-4-2-1-3-5-16/h1-13H,14H2,(H,24,26)(H2,23,25,27) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 700 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441587
![PNG](/data/jpeg/tenK5044/BindingDB_50441587.png) (CHEMBL2437157)Show SMILES O=C(Cc1ccc(cc1)-c1ccccc1)NNC(=S)NCCCCC1CCCCC1 Show InChI InChI=1S/C25H33N3OS/c29-24(19-21-14-16-23(17-15-21)22-12-5-2-6-13-22)27-28-25(30)26-18-8-7-11-20-9-3-1-4-10-20/h2,5-6,12-17,20H,1,3-4,7-11,18-19H2,(H,27,29)(H2,26,28,30) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 730 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441589
![PNG](/data/jpeg/tenK5044/BindingDB_50441589.png) (CHEMBL2437160)Show SMILES [O-][N+](=O)c1ccc(OCC(=O)NNC(=S)NCCCCC2CCCCC2)cc1 Show InChI InChI=1S/C19H28N4O4S/c24-18(14-27-17-11-9-16(10-12-17)23(25)26)21-22-19(28)20-13-5-4-8-15-6-2-1-3-7-15/h9-12,15H,1-8,13-14H2,(H,21,24)(H2,20,22,28) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 790 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441589
![PNG](/data/jpeg/tenK5044/BindingDB_50441589.png) (CHEMBL2437160)Show SMILES [O-][N+](=O)c1ccc(OCC(=O)NNC(=S)NCCCCC2CCCCC2)cc1 Show InChI InChI=1S/C19H28N4O4S/c24-18(14-27-17-11-9-16(10-12-17)23(25)26)21-22-19(28)20-13-5-4-8-15-6-2-1-3-7-15/h9-12,15H,1-8,13-14H2,(H,21,24)(H2,20,22,28) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 810 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441588
![PNG](/data/jpeg/tenK5044/BindingDB_50441588.png) (CHEMBL2437159)Show InChI InChI=1S/C23H31N3O2S/c27-22(17-28-21-15-8-13-19-12-4-5-14-20(19)21)25-26-23(29)24-16-7-6-11-18-9-2-1-3-10-18/h4-5,8,12-15,18H,1-3,6-7,9-11,16-17H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 880 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441600
![PNG](/data/jpeg/tenK5044/BindingDB_50441600.png) (CHEMBL2437165)Show InChI InChI=1S/C19H22ClN3O2S/c20-16-9-11-17(12-10-16)25-14-18(24)22-23-19(26)21-13-5-4-8-15-6-2-1-3-7-15/h1-3,6-7,9-12H,4-5,8,13-14H2,(H,22,24)(H2,21,23,26) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441611
![PNG](/data/jpeg/tenK5044/BindingDB_50441611.png) (CHEMBL2437180)Show SMILES O=C(COc1ccc(OCc2ccccc2)cc1)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C29H27N3O3S/c33-28(21-35-27-17-15-26(16-18-27)34-20-23-7-3-1-4-8-23)31-32-29(36)30-19-22-11-13-25(14-12-22)24-9-5-2-6-10-24/h1-18H,19-21H2,(H,31,33)(H2,30,32,36) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441588
![PNG](/data/jpeg/tenK5044/BindingDB_50441588.png) (CHEMBL2437159)Show InChI InChI=1S/C23H31N3O2S/c27-22(17-28-21-15-8-13-19-12-4-5-14-20(19)21)25-26-23(29)24-16-7-6-11-18-9-2-1-3-10-18/h4-5,8,12-15,18H,1-3,6-7,9-11,16-17H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441585
![PNG](/data/jpeg/tenK5044/BindingDB_50441585.png) (CHEMBL2437148)Show InChI InChI=1S/C20H24ClN3O2S/c1-24(14-6-5-9-16-7-3-2-4-8-16)20(27)23-22-19(25)15-26-18-12-10-17(21)11-13-18/h2-4,7-8,10-13H,5-6,9,14-15H2,1H3,(H,22,25)(H,23,27) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.10E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441613
![PNG](/data/jpeg/tenK5044/BindingDB_50441613.png) (CHEMBL2437182)Show SMILES Clc1ccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)cc1Cl Show InChI InChI=1S/C22H19Cl2N3O2S/c23-19-11-10-18(12-20(19)24)29-14-21(28)26-27-22(30)25-13-15-6-8-17(9-7-15)16-4-2-1-3-5-16/h1-12H,13-14H2,(H,26,28)(H2,25,27,30) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.20E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441614
![PNG](/data/jpeg/tenK5044/BindingDB_50441614.png) (CHEMBL2437183)Show SMILES Clc1ccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)c(Cl)c1 Show InChI InChI=1S/C22H19Cl2N3O2S/c23-18-10-11-20(19(24)12-18)29-14-21(28)26-27-22(30)25-13-15-6-8-17(9-7-15)16-4-2-1-3-5-16/h1-12H,13-14H2,(H,26,28)(H2,25,27,30) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.20E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441619
![PNG](/data/jpeg/tenK5044/BindingDB_50441619.png) (CHEMBL2437189)Show SMILES Clc1ccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)cc1 Show InChI InChI=1S/C22H20ClN3O2S/c23-19-10-12-20(13-11-19)28-15-21(27)25-26-22(29)24-14-16-6-8-18(9-7-16)17-4-2-1-3-5-17/h1-13H,14-15H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.20E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441599
![PNG](/data/jpeg/tenK5044/BindingDB_50441599.png) (CHEMBL2437158)Show SMILES Clc1ccc2OC(CNc2c1)C(=O)NNC(=S)NCCCCC1CCCCC1 Show InChI InChI=1S/C20H29ClN4O2S/c21-15-9-10-17-16(12-15)23-13-18(27-17)19(26)24-25-20(28)22-11-5-4-8-14-6-2-1-3-7-14/h9-10,12,14,18,23H,1-8,11,13H2,(H,24,26)(H2,22,25,28) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.26E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441586
![PNG](/data/jpeg/tenK5044/BindingDB_50441586.png) (CHEMBL2437153)Show InChI InChI=1S/C18H26ClN3OS/c19-16-11-9-15(10-12-16)17(23)21-22-18(24)20-13-5-4-8-14-6-2-1-3-7-14/h9-12,14H,1-8,13H2,(H,21,23)(H2,20,22,24) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.40E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441591
![PNG](/data/jpeg/tenK5044/BindingDB_50441591.png) (CHEMBL2437167)Show InChI InChI=1S/C18H20ClN3O2S/c19-15-8-10-16(11-9-15)24-13-17(23)21-22-18(25)20-12-4-7-14-5-2-1-3-6-14/h1-3,5-6,8-11H,4,7,12-13H2,(H,21,23)(H2,20,22,25) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.40E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441585
![PNG](/data/jpeg/tenK5044/BindingDB_50441585.png) (CHEMBL2437148)Show InChI InChI=1S/C20H24ClN3O2S/c1-24(14-6-5-9-16-7-3-2-4-8-16)20(27)23-22-19(25)15-26-18-12-10-17(21)11-13-18/h2-4,7-8,10-13H,5-6,9,14-15H2,1H3,(H,22,25)(H,23,27) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.50E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441601
![PNG](/data/jpeg/tenK5044/BindingDB_50441601.png) (CHEMBL2437166)Show InChI InChI=1S/C15H18ClN5O2S/c16-12-2-4-13(5-3-12)23-10-14(22)19-20-15(24)18-6-1-8-21-9-7-17-11-21/h2-5,7,9,11H,1,6,8,10H2,(H,19,22)(H2,18,20,24) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.60E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441596
![PNG](/data/jpeg/tenK5044/BindingDB_50441596.png) (CHEMBL2437147)Show SMILES Clc1ccc(OCC(=O)NNC(=S)N2CCC(Cc3ccccc3)CC2)cc1 Show InChI InChI=1S/C21H24ClN3O2S/c22-18-6-8-19(9-7-18)27-15-20(26)23-24-21(28)25-12-10-17(11-13-25)14-16-4-2-1-3-5-16/h1-9,17H,10-15H2,(H,23,26)(H,24,28) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.60E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441593
![PNG](/data/jpeg/tenK5044/BindingDB_50441593.png) (CHEMBL2437173)Show SMILES Clc1ccc(cc1)C(=O)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C21H18ClN3OS/c22-19-12-10-18(11-13-19)20(26)24-25-21(27)23-14-15-6-8-17(9-7-15)16-4-2-1-3-5-16/h1-13H,14H2,(H,24,26)(H2,23,25,27) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.60E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441617
![PNG](/data/jpeg/tenK5044/BindingDB_50441617.png) (CHEMBL2437186)Show SMILES FC(F)(F)c1ccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)cc1 Show InChI InChI=1S/C23H20F3N3O2S/c24-23(25,26)19-10-12-20(13-11-19)31-15-21(30)28-29-22(32)27-14-16-6-8-18(9-7-16)17-4-2-1-3-5-17/h1-13H,14-15H2,(H,28,30)(H2,27,29,32) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.70E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441612
![PNG](/data/jpeg/tenK5044/BindingDB_50441612.png) (CHEMBL2437181)Show SMILES COc1ccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)cc1 Show InChI InChI=1S/C23H23N3O3S/c1-28-20-11-13-21(14-12-20)29-16-22(27)25-26-23(30)24-15-17-7-9-19(10-8-17)18-5-3-2-4-6-18/h2-14H,15-16H2,1H3,(H,25,27)(H2,24,26,30) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.70E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441616
![PNG](/data/jpeg/tenK5044/BindingDB_50441616.png) (CHEMBL2437185)Show SMILES Clc1ccccc1OCC(=O)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C22H20ClN3O2S/c23-19-8-4-5-9-20(19)28-15-21(27)25-26-22(29)24-14-16-10-12-18(13-11-16)17-6-2-1-3-7-17/h1-13H,14-15H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.90E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441591
![PNG](/data/jpeg/tenK5044/BindingDB_50441591.png) (CHEMBL2437167)Show InChI InChI=1S/C18H20ClN3O2S/c19-15-8-10-16(11-9-15)24-13-17(23)21-22-18(25)20-12-4-7-14-5-2-1-3-6-14/h1-3,5-6,8-11H,4,7,12-13H2,(H,21,23)(H2,20,22,25) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 2.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441615
![PNG](/data/jpeg/tenK5044/BindingDB_50441615.png) (CHEMBL2437184)Show SMILES Clc1cccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)c1 Show InChI InChI=1S/C22H20ClN3O2S/c23-19-7-4-8-20(13-19)28-15-21(27)25-26-22(29)24-14-16-9-11-18(12-10-16)17-5-2-1-3-6-17/h1-13H,14-15H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 2.10E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441604
![PNG](/data/jpeg/tenK5044/BindingDB_50441604.png) (CHEMBL2437171)Show SMILES Clc1ccc(OCC(=O)NNC(=S)NCc2cccc(c2)-c2ccccc2)cc1 Show InChI InChI=1S/C22H20ClN3O2S/c23-19-9-11-20(12-10-19)28-15-21(27)25-26-22(29)24-14-16-5-4-8-18(13-16)17-6-2-1-3-7-17/h1-13H,14-15H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 2.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441602
![PNG](/data/jpeg/tenK5044/BindingDB_50441602.png) (CHEMBL2437168)Show InChI InChI=1S/C17H18ClN3O2S/c18-14-6-8-15(9-7-14)23-12-16(22)20-21-17(24)19-11-10-13-4-2-1-3-5-13/h1-9H,10-12H2,(H,20,22)(H2,19,21,24) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 2.80E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4
(Homo sapiens (Human)) | BDBM50441592
![PNG](/data/jpeg/tenK5044/BindingDB_50441592.png) (CHEMBL2437170)Show SMILES Clc1ccc(OCC(=O)NNC(=S)NCc2ccccc2-c2ccccc2)cc1 Show InChI InChI=1S/C22H20ClN3O2S/c23-18-10-12-19(13-11-18)28-15-21(27)25-26-22(29)24-14-17-8-4-5-9-20(17)16-6-2-1-3-7-16/h1-13H,14-15H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 2.90E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441597
![PNG](/data/jpeg/tenK5044/BindingDB_50441597.png) (CHEMBL2437155)Show SMILES O=C(Cc1nc(no1)-c1cnccn1)NNC(=S)NCCCCC1CCCCC1 Show InChI InChI=1S/C19H27N7O2S/c27-16(12-17-23-18(26-28-17)15-13-20-10-11-21-15)24-25-19(29)22-9-5-4-8-14-6-2-1-3-7-14/h10-11,13-14H,1-9,12H2,(H,24,27)(H2,22,25,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 3.10E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441610
![PNG](/data/jpeg/tenK5044/BindingDB_50441610.png) (CHEMBL2437178)Show SMILES O=C(COc1ccc2ccccc2c1)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C26H23N3O2S/c30-25(18-31-24-15-14-21-8-4-5-9-23(21)16-24)28-29-26(32)27-17-19-10-12-22(13-11-19)20-6-2-1-3-7-20/h1-16H,17-18H2,(H,28,30)(H2,27,29,32) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 3.20E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441606
![PNG](/data/jpeg/tenK5044/BindingDB_50441606.png) (CHEMBL2437175)Show SMILES Clc1ccc2OC(CNc2c1)C(=O)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C23H21ClN4O2S/c24-18-10-11-20-19(12-18)25-14-21(30-20)22(29)27-28-23(31)26-13-15-6-8-17(9-7-15)16-4-2-1-3-5-16/h1-12,21,25H,13-14H2,(H,27,29)(H2,26,28,31) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 3.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441608
![PNG](/data/jpeg/tenK5044/BindingDB_50441608.png) (CHEMBL2437176)Show SMILES [O-][N+](=O)c1ccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)cc1 Show InChI InChI=1S/C22H20N4O4S/c27-21(15-30-20-12-10-19(11-13-20)26(28)29)24-25-22(31)23-14-16-6-8-18(9-7-16)17-4-2-1-3-5-17/h1-13H,14-15H2,(H,24,27)(H2,23,25,31) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 4.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441609
![PNG](/data/jpeg/tenK5044/BindingDB_50441609.png) (CHEMBL2437177)Show SMILES O=C(COc1cccc2ccccc12)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C26H23N3O2S/c30-25(18-31-24-12-6-10-22-9-4-5-11-23(22)24)28-29-26(32)27-17-19-13-15-21(16-14-19)20-7-2-1-3-8-20/h1-16H,17-18H2,(H,28,30)(H2,27,29,32) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 4.10E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441595
![PNG](/data/jpeg/tenK5044/BindingDB_50441595.png) (CHEMBL2437146)Show SMILES Clc1ccc(CCNC(=S)NNC(=O)Cc2ccc(cc2)-c2ccccc2)cc1 Show InChI InChI=1S/C23H22ClN3OS/c24-21-12-8-17(9-13-21)14-15-25-23(29)27-26-22(28)16-18-6-10-20(11-7-18)19-4-2-1-3-5-19/h1-13H,14-16H2,(H,26,28)(H2,25,27,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 5.20E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441605
![PNG](/data/jpeg/tenK5044/BindingDB_50441605.png) (CHEMBL2437172)Show SMILES Clc1ccc(NCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)cc1 Show InChI InChI=1S/C22H21ClN4OS/c23-19-10-12-20(13-11-19)24-15-21(28)26-27-22(29)25-14-16-6-8-18(9-7-16)17-4-2-1-3-5-17/h1-13,24H,14-15H2,(H,26,28)(H2,25,27,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 6.30E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441607
![PNG](/data/jpeg/tenK5044/BindingDB_50441607.png) (CHEMBL2437174)Show SMILES CC(C)(Oc1ccc(Cl)cc1)C(=O)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C24H24ClN3O2S/c1-24(2,30-21-14-12-20(25)13-15-21)22(29)27-28-23(31)26-16-17-8-10-19(11-9-17)18-6-4-3-5-7-18/h3-15H,16H2,1-2H3,(H,27,29)(H2,26,28,31) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 6.90E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441594
![PNG](/data/jpeg/tenK5044/BindingDB_50441594.png) (CHEMBL2437145)Show InChI InChI=1S/C19H21ClN2O3S/c20-15-6-8-16(9-7-15)25-13-18(23)22-12-17(26)19(24)21-11-10-14-4-2-1-3-5-14/h1-9,17,26H,10-13H2,(H,21,24)(H,22,23) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL KEGG PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 8.70E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
Disintegrin and metalloproteinase domain-containing protein 17
(Homo sapiens (Human)) | BDBM50441574
![PNG](/data/jpeg/tenK5044/BindingDB_50441574.png) (CHEMBL2437163)Show InChI InChI=1S/C19H28ClN3O2S/c20-16-9-11-17(12-10-16)25-14-18(24)22-23-19(26)21-13-5-4-8-15-6-2-1-3-7-15/h9-12,15H,1-8,13-14H2,(H,22,24)(H2,21,23,26) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | >1.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human TACE after 5 mins |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441618
![PNG](/data/jpeg/tenK5044/BindingDB_50441618.png) (CHEMBL2437187)Show SMILES O=C(COc1ccccc1)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C22H21N3O2S/c26-21(16-27-20-9-5-2-6-10-20)24-25-22(28)23-15-17-11-13-19(14-12-17)18-7-3-1-4-8-18/h1-14H,15-16H2,(H,24,26)(H2,23,25,28) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441603
![PNG](/data/jpeg/tenK5044/BindingDB_50441603.png) (CHEMBL1422461)Show InChI InChI=1S/C16H16ClN3O2S/c17-13-6-8-14(9-7-13)22-11-15(21)19-20-16(23)18-10-12-4-2-1-3-5-12/h1-9H,10-11H2,(H,19,21)(H2,18,20,23) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| Purchase
CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.26E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441584
![PNG](/data/jpeg/tenK5044/BindingDB_50441584.png) (CHEMBL2437179)Show SMILES O=C(COc1ccc(cc1)-c1ccccc1)NNC(=S)NCc1ccc(cc1)-c1ccccc1 Show InChI InChI=1S/C28H25N3O2S/c32-27(20-33-26-17-15-25(16-18-26)23-9-5-2-6-10-23)30-31-28(34)29-19-21-11-13-24(14-12-21)22-7-3-1-4-8-22/h1-18H,19-20H2,(H,30,32)(H2,29,31,34) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 6.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441583
![PNG](/data/jpeg/tenK5044/BindingDB_50441583.png) (CHEMBL2437188)Show SMILES Fc1ccc(OCC(=O)NNC(=S)NCc2ccc(cc2)-c2ccccc2)cc1 Show InChI InChI=1S/C22H20FN3O2S/c23-19-10-12-20(13-11-19)28-15-21(27)25-26-22(29)24-14-16-6-8-18(9-7-16)17-4-2-1-3-5-17/h1-13H,14-15H2,(H,25,27)(H2,24,26,29) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | 1.00E+5 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5
(Homo sapiens (Human)) | BDBM50441582
![PNG](/data/jpeg/tenK5044/BindingDB_50441582.png) (CHEMBL2437162)Show InChI InChI=1S/C19H29N3O2S/c23-18(15-24-17-12-5-2-6-13-17)21-22-19(25)20-14-8-7-11-16-9-3-1-4-10-16/h2,5-6,12-13,16H,1,3-4,7-11,14-15H2,(H,21,23)(H2,20,22,25) | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| CHEMBL PC cid PC sid UniChem
Similars
| Article PubMed
| n/a | n/a | >1.00E+5 | n/a | n/a | n/a | n/a | n/a | n/a |
INSERM
Curated by ChEMBL
| Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a... |
Eur J Med Chem 69: 244-61 (2013)
Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM |
More data for this Ligand-Target Pair | |