Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase protein |
---|
Ligand | BDBM50484634 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_798903 (CHEMBL1943410) |
---|
Ki | 5.3±n/a nM |
---|
Citation | Gomez, R; Jolly, SJ; Williams, T; Vacca, JP; Torrent, M; McGaughey, G; Lai, MT; Felock, P; Munshi, V; Distefano, D; Flynn, J; Miller, M; Yan, Y; Reid, J; Sanchez, R; Liang, Y; Paton, B; Wan, BL; Anthony, N Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase. J Med Chem54:7920-33 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase protein |
---|
Name: | Reverse transcriptase protein |
Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
Type: | Protein |
Mol. Mass.: | 30203.56 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WJQ2 |
Residue: | 259 |
Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
BDBM50484634 |
---|
n/a |
---|
Name | BDBM50484634 |
Synonyms: | CHEMBL1939504 |
Type | Small organic molecule |
Emp. Form. | C21H12Cl2N6O |
Mol. Mass. | 435.266 |
SMILES | Clc1cc(Oc2c(Cl)ccc3n(Cc4n[nH]c5ncccc45)cnc23)cc(c1)C#N |
Structure |
|