Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Ketohexokinase |
---|
Ligand | BDBM319582 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2022241 (CHEMBL4676054) |
---|
IC50 | 6.0±n/a nM |
---|
Citation | Futatsugi, K; Smith, AC; Tu, M; Raymer, B; Ahn, K; Coffey, SB; Dowling, MS; Fernando, DP; Gutierrez, JA; Huard, K; Jasti, J; Kalgutkar, AS; Knafels, JD; Pandit, J; Parris, KD; Perez, S; Pfefferkorn, JA; Price, DA; Ryder, T; Shavnya, A; Stock, IA; Tsai, AS; Tesz, GJ; Thuma, BA; Weng, Y; Wisniewska, HM; Xing, G; Zhou, J; Magee, TV Discovery of PF-06835919: A Potent Inhibitor of Ketohexokinase (KHK) for the Treatment of Metabolic Disorders Driven by the Overconsumption of Fructose. J Med Chem63:13546-13560 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ketohexokinase |
---|
Name: | Ketohexokinase |
Synonyms: | Hepatic fructokinase | KHK | KHK_HUMAN | Ketohexokinase | Ketohexokinase (KHK) | Ketohexokinase (KHK) Isoform C |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 32521.64 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 298 |
Sequence: | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
|
|
|
BDBM319582 |
---|
n/a |
---|
Name | BDBM319582 |
Synonyms: | US10174007, Example 1 | US10787438, Example 1 | US10988463, Example 1 | US11634410, Example 1 |
Type | Small organic molecule |
Emp. Form. | C18H19F3N4O3 |
Mol. Mass. | 396.3637 |
SMILES | C[C@H]1[C@H](O)CN1c1nc(cc(c1C#N)C(F)(F)F)N1C[C@H]2[C@H](CC(O)=O)[C@H]2C1 |r| |
Structure |
|