| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ketohexokinase |
|---|
| Ligand | BDBM319585 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2022253 (CHEMBL4676066) |
|---|
| IC50 | 210±n/a nM |
|---|
| Citation |  Futatsugi, K; Smith, AC; Tu, M; Raymer, B; Ahn, K; Coffey, SB; Dowling, MS; Fernando, DP; Gutierrez, JA; Huard, K; Jasti, J; Kalgutkar, AS; Knafels, JD; Pandit, J; Parris, KD; Perez, S; Pfefferkorn, JA; Price, DA; Ryder, T; Shavnya, A; Stock, IA; Tsai, AS; Tesz, GJ; Thuma, BA; Weng, Y; Wisniewska, HM; Xing, G; Zhou, J; Magee, TV Discovery of PF-06835919: A Potent Inhibitor of Ketohexokinase (KHK) for the Treatment of Metabolic Disorders Driven by the Overconsumption of Fructose. J Med Chem63:13546-13560 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ketohexokinase |
|---|
| Name: | Ketohexokinase |
|---|
| Synonyms: | 2.7.1.3 | Hepatic fructokinase | KHK_RAT | Ketohexokinase | Khk |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32749.44 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_117528 |
|---|
| Residue: | 298 |
|---|
| Sequence: | MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASNSCTVLSLLGARCAFM
GSLAHGHVADFLVADFRRRGVDVSQVAWQSQGDTPCSCCIVNNSNGSRTIILYDTNLPDV
SAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEQYNATQPLQQKVRVSVEIEKPREELF
QLFGYGEVVFVSKDVAKHLGFRSAGEALKGLYSRVKKGATLICAWAEEGADALGPDGQLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFGCQVAGKKCGLQGFDGIV
|
|
|
|---|
| BDBM319585 |
|---|
| n/a |
|---|
| Name | BDBM319585 |
|---|
| Synonyms: | US10174007, Example 4 | US10787438, Example 4 | US10988463, Example 4 | US11634410, Example 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19F3N4O2 |
|---|
| Mol. Mass. | 356.3429 |
|---|
| SMILES | C[C@H]1CCN1c1nc(cc(n1)C(F)(F)F)N1C[C@H]2[C@H](CC(O)=O)[C@H]2C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
