Reaction Details |
| Report a problem with these data |
Target | Ketohexokinase |
---|
Ligand | BDBM319585 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2022253 (CHEMBL4676066) |
---|
IC50 | 210±n/a nM |
---|
Citation | Futatsugi, K; Smith, AC; Tu, M; Raymer, B; Ahn, K; Coffey, SB; Dowling, MS; Fernando, DP; Gutierrez, JA; Huard, K; Jasti, J; Kalgutkar, AS; Knafels, JD; Pandit, J; Parris, KD; Perez, S; Pfefferkorn, JA; Price, DA; Ryder, T; Shavnya, A; Stock, IA; Tsai, AS; Tesz, GJ; Thuma, BA; Weng, Y; Wisniewska, HM; Xing, G; Zhou, J; Magee, TV Discovery of PF-06835919: A Potent Inhibitor of Ketohexokinase (KHK) for the Treatment of Metabolic Disorders Driven by the Overconsumption of Fructose. J Med Chem63:13546-13560 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ketohexokinase |
---|
Name: | Ketohexokinase |
Synonyms: | 2.7.1.3 | Hepatic fructokinase | KHK_RAT | Ketohexokinase | Khk |
Type: | PROTEIN |
Mol. Mass.: | 32749.44 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_117528 |
Residue: | 298 |
Sequence: | MEEKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASNSCTVLSLLGARCAFM
GSLAHGHVADFLVADFRRRGVDVSQVAWQSQGDTPCSCCIVNNSNGSRTIILYDTNLPDV
SAKDFEKVDLTRFKWIHIEGRNASEQVKMLQRIEQYNATQPLQQKVRVSVEIEKPREELF
QLFGYGEVVFVSKDVAKHLGFRSAGEALKGLYSRVKKGATLICAWAEEGADALGPDGQLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSKGNSMQEALRFGCQVAGKKCGLQGFDGIV
|
|
|
BDBM319585 |
---|
n/a |
---|
Name | BDBM319585 |
Synonyms: | US10174007, Example 4 | US10787438, Example 4 | US10988463, Example 4 | US11634410, Example 4 |
Type | Small organic molecule |
Emp. Form. | C16H19F3N4O2 |
Mol. Mass. | 356.3429 |
SMILES | C[C@H]1CCN1c1nc(cc(n1)C(F)(F)F)N1C[C@H]2[C@H](CC(O)=O)[C@H]2C1 |r| |
Structure |
|