Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cyclin-dependent kinase 3 |
---|
Ligand | BDBM50528817 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2025085 (CHEMBL4678898) |
---|
IC50 | 23±n/a nM |
---|
Citation | Barlaam, B; Casella, R; Cidado, J; Cook, C; De Savi, C; Dishington, A; Donald, CS; Drew, L; Ferguson, AD; Ferguson, D; Glossop, S; Grebe, T; Gu, C; Hande, S; Hawkins, J; Hird, AW; Holmes, J; Horstick, J; Jiang, Y; Lamb, ML; McGuire, TM; Moore, JE; O'Connell, N; Pike, A; Pike, KG; Proia, T; Roberts, B; San Martin, M; Sarkar, U; Shao, W; Stead, D; Sumner, N; Thakur, K; Vasbinder, MM; Varnes, JG; Wang, J; Wang, L; Wu, D; Wu, L; Yang, B; Yao, T Discovery of AZD4573, a Potent and Selective Inhibitor of CDK9 That Enables Short Duration of Target Engagement for the Treatment of Hematological Malignancies. J Med Chem63:15564-15590 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 3 |
---|
Name: | Cyclin-dependent kinase 3 |
Synonyms: | CDK3 | CDK3/Cyclin E | CDK3_HUMAN | CDKN3 | Cyclin-dependent kinase 3 | Cyclin-dependent kinase 3 (CDK3) |
Type: | Enzyme |
Mol. Mass.: | 35053.88 |
Organism: | Homo sapiens (Human) |
Description: | Q00526 |
Residue: | 305 |
Sequence: | MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH
|
|
|
BDBM50528817 |
---|
n/a |
---|
Name | BDBM50528817 |
Synonyms: | CHEMBL4462530 | US10717746, Example 14 | US20230416221, Compound AZD4573 |
Type | Small organic molecule |
Emp. Form. | C22H28ClN5O2 |
Mol. Mass. | 429.943 |
SMILES | CC(=O)N[C@@H]1CCC[C@@H](C1)C(=O)Nc1cc(-c2cnn3CC(C)(C)Cc23)c(Cl)cn1 |r| |
Structure |
|