| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 3 |
|---|
| Ligand | BDBM454542 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2025085 (CHEMBL4678898) |
|---|
| IC50 | 20±n/a nM |
|---|
| Citation |  Barlaam, B; Casella, R; Cidado, J; Cook, C; De Savi, C; Dishington, A; Donald, CS; Drew, L; Ferguson, AD; Ferguson, D; Glossop, S; Grebe, T; Gu, C; Hande, S; Hawkins, J; Hird, AW; Holmes, J; Horstick, J; Jiang, Y; Lamb, ML; McGuire, TM; Moore, JE; O'Connell, N; Pike, A; Pike, KG; Proia, T; Roberts, B; San Martin, M; Sarkar, U; Shao, W; Stead, D; Sumner, N; Thakur, K; Vasbinder, MM; Varnes, JG; Wang, J; Wang, L; Wu, D; Wu, L; Yang, B; Yao, T Discovery of AZD4573, a Potent and Selective Inhibitor of CDK9 That Enables Short Duration of Target Engagement for the Treatment of Hematological Malignancies. J Med Chem63:15564-15590 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 3 |
|---|
| Name: | Cyclin-dependent kinase 3 |
|---|
| Synonyms: | CDK3 | CDK3/Cyclin E | CDK3_HUMAN | CDKN3 | Cyclin-dependent kinase 3 | Cyclin-dependent kinase 3 (CDK3) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 35053.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00526 |
|---|
| Residue: | 305 |
|---|
| Sequence: | MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
QRFRH
|
|
|
|---|
| BDBM454542 |
|---|
| n/a |
|---|
| Name | BDBM454542 |
|---|
| Synonyms: | US10717746, Example 25 | US10717746, Example 84 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28FN5O2 |
|---|
| Mol. Mass. | 413.4884 |
|---|
| SMILES | CC(=O)N[C@@H]1CCC[C@@H](C1)C(=O)Nc1cc(-c2cnn3CC(C)(C)Cc23)c(F)cn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
