| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50233283 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1650402 (CHEMBL3999536) |
|---|
| IC50 | 1.000000±n/a nM |
|---|
| Citation |  Partridge, KM; Antonysamy, S; Bhattachar, SN; Chandrasekhar, S; Fisher, MJ; Fretland, A; Gooding, K; Harvey, A; Hughes, NE; Kuklish, SL; Luz, JG; Manninen, PR; McGee, JE; Mudra, DR; Navarro, A; Norman, BH; Quimby, SJ; Schiffler, MA; Sloan, AV; Warshawsky, AM; Weller, JM; York, JS; Yu, XP Discovery and characterization of [(cyclopentyl)ethyl]benzoic acid inhibitors of microsomal prostaglandin E synthase-1. Bioorg Med Chem Lett27:1478-1483 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50233283 |
|---|
| n/a |
|---|
| Name | BDBM50233283 |
|---|
| Synonyms: | CHEMBL4102262 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H30ClF3N2O3 |
|---|
| Mol. Mass. | 522.987 |
|---|
| SMILES | OC(=O)c1ccc(Cl)cc1CC[C@@H]1CCC[C@@H]1NC(=O)C1CCN(CC1)c1ccc(cc1)C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
