| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50479470 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_798903 (CHEMBL1943410) |
|---|
| Ki | 0.390000±n/a nM |
|---|
| Citation |  Gomez, R; Jolly, SJ; Williams, T; Vacca, JP; Torrent, M; McGaughey, G; Lai, MT; Felock, P; Munshi, V; Distefano, D; Flynn, J; Miller, M; Yan, Y; Reid, J; Sanchez, R; Liang, Y; Paton, B; Wan, BL; Anthony, N Design and synthesis of conformationally constrained inhibitors of non-nucleoside reverse transcriptase. J Med Chem54:7920-33 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50479470 |
|---|
| n/a |
|---|
| Name | BDBM50479470 |
|---|
| Synonyms: | CHEMBL489586 | MK-4965 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H13Cl2N5O2 |
|---|
| Mol. Mass. | 426.256 |
|---|
| SMILES | Nc1ccc2c(COc3ccc(Cl)c(Oc4cc(Cl)cc(c4)C#N)c3)n[nH]c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
