| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinol-binding protein 4 |
|---|
| Ligand | BDBM50019064 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1361118 (CHEMBL3291833) |
|---|
| IC50 | 3.0±n/a nM |
|---|
| Citation |  Wang, Y; Connors, R; Fan, P; Wang, X; Wang, Z; Liu, J; Kayser, F; Medina, JC; Johnstone, S; Xu, H; Thibault, S; Walker, N; Conn, M; Zhang, Y; Liu, Q; Grillo, MP; Motani, A; Coward, P; Wang, Z Structure-assisted discovery of the first non-retinoid ligands for Retinol-Binding Protein 4. Bioorg Med Chem Lett24:2885-91 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinol-binding protein 4 |
|---|
| Name: | Retinol-binding protein 4 |
|---|
| Synonyms: | PRBP | Plasma retinol-binding protein | RBP | RBP4 | RET4_HUMAN | Retinol-binding protein 4 | Retinol-binding protein 4 (RBP4) | spa binding assay for rbp4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23008.75 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P02753 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
|
|
|
|---|
| BDBM50019064 |
|---|
| n/a |
|---|
| Name | BDBM50019064 |
|---|
| Synonyms: | CHEMBL3288340 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15F3N2OS |
|---|
| Mol. Mass. | 340.363 |
|---|
| SMILES | FC(F)(F)c1ccccc1C1CCN(CC1)C(=O)c1nccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
