Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50033875 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1435797 (CHEMBL3389552) |
---|
IC50 | 120±n/a nM |
---|
Citation | Famiglini, V; La Regina, G; Coluccia, A; Pelliccia, S; Brancale, A; Maga, G; Crespan, E; Badia, R; Riveira-Muñoz, E; Esté, JA; Ferretti, R; Cirilli, R; Zamperini, C; Botta, M; Schols, D; Limongelli, V; Agostino, B; Novellino, E; Silvestri, R Indolylarylsulfones carrying a heterocyclic tail as very potent and broad spectrum HIV-1 non-nucleoside reverse transcriptase inhibitors. J Med Chem57:9945-57 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50033875 |
---|
n/a |
---|
Name | BDBM50033875 |
Synonyms: | CHEMBL3358167 |
Type | Small organic molecule |
Emp. Form. | C24H22ClN3O3S |
Mol. Mass. | 467.968 |
SMILES | CC(NC(=O)c1[nH]c2ccc(Cl)cc2c1S(=O)(=O)c1cc(C)cc(C)c1)c1cccnc1 |
Structure |
|