Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInward rectifier potassium channel 13
LigandBDBM155928
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1515522
IC50>10000±n/a nM
Citation Walsh SPShahripour ATang HTeumelsan NFrie JZhu YPriest BTSwensen AMLiu JMargulis MVisconti RWeinglass AFelix JPBrochu RMBailey TThomas-Fowlkes BAlonso-Galicia MZhou XPai LYCorona AHampton CHernandez MBentley RChen JShah KMetzger JForrest MOwens KTong VHa SRoy SKaczorowski GJYang LParmee EGarcia MLSullivan KPasternak A Discovery of a Potent and Selective ROMK Inhibitor with Pharmacokinetic Properties Suitable for Preclinical Evaluation. ACS Med Chem Lett 6:747-52 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Inward rectifier potassium channel 13
Name:Inward rectifier potassium channel 13
Synonyms:Inward rectifier K(+) channel Kir7.1 | KCNJ13 | Potassium channel, inwardly rectifying subfamily J member 13
Type:PROTEIN
Mol. Mass.:40527.12
Organism:Homo sapiens (Human)
Description:ChEMBL_105176
Residue:360
Sequence:
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM155928
n/a
NameBDBM155928
Synonyms:US9018211, 52
TypeSmall organic molecule
Emp. Form.C24H28N4O5
Mol. Mass.452.5029
SMILESCOc1cc(ncc1C#N)[C@@H](O)CN1CCN(C[C@H](O)c2ccc3C(=O)OCc3c2C)CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: