Reaction Details |
| Report a problem with these data |
Target | Platelet-derived growth factor receptor alpha [551-1089,V561D] |
---|
Ligand | BDBM225230 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | HMT Assay |
---|
IC50 | >1.0e+4±n/a nM |
---|
Citation | Qi, W; Zhao, K; Gu, J; Huang, Y; Wang, Y; Zhang, H; Zhang, M; Zhang, J; Yu, Z; Li, L; Teng, L; Chuai, S; Zhang, C; Zhao, M; Chan, H; Chen, Z; Fang, D; Fei, Q; Feng, L; Feng, L; Gao, Y; Ge, H; Ge, X; Li, G; Lingel, A; Lin, Y; Liu, Y; Luo, F; Shi, M; Wang, L; Wang, Z; Yu, Y; Zeng, J; Zeng, C; Zhang, L; Zhang, Q; Zhou, S; Oyang, C; Atadja, P; Li, E An allosteric PRC2 inhibitor targeting the H3K27me3 binding pocket of EED. Nat Chem Biol13:381-388 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Platelet-derived growth factor receptor alpha [551-1089,V561D] |
---|
Name: | Platelet-derived growth factor receptor alpha [551-1089,V561D] |
Synonyms: | PDGFR2 | PDGFRA | PGFRA_HUMAN | Platelet-derived growth factor receptor alpha (PDGFRa) | RHEPDGFRA |
Type: | Enzyme |
Mol. Mass.: | 61429.19 |
Organism: | Homo sapiens (Human) |
Description: | Human PDGFRa truncation (551-1089 aa) with V561D mutation |
Residue: | 539 |
Sequence: | QKPRYEIRWRDIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEG
TAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPI
YIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSYVILSFENNGD
YMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGL
TLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYV
SKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIK
SGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFL
KSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPE
EEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL
|
|
|
BDBM225230 |
---|
n/a |
---|
Name | BDBM225230 |
Synonyms: | EED226 | US11013745, Compound EED226 |
Type | Small organic molecule |
Emp. Form. | C17H15N5O3S |
Mol. Mass. | 369.398 |
SMILES | CS(=O)(=O)c1ccc(cc1)-c1cnc(NCc2ccco2)n2cnnc12 |
Structure |
|