Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM772 |
---|
Substrate/Competitor | BDBM12679 |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 4800±n/a nM |
---|
Citation | Katz, BA; Elrod, K; Luong, C; Rice, MJ; Mackman, RL; Sprengeler, PA; Spencer, J; Hataye, J; Janc, J; Link, J; Litvak, J; Rai, R; Rice, K; Sideris, S; Verner, E; Young, W A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site. J Mol Biol307:1451-86 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM772 |
---|
BDBM12679 |
---|
Name | BDBM772 |
Synonyms: | Benzamidine | CHEMBL79897 | [amino(phenyl)methylidene]azanium | benzamidine deriv. | benzamidinium chloride |
Type | n/a |
Emp. Form. | C7H9N2 |
Mol. Mass. | 121.1592 |
SMILES | NC(=[NH2+])c1ccccc1 |
Structure |
|