Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM50526515 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1900120 (CHEMBL4402235) |
---|
IC50 | 73±n/a nM |
---|
Citation | Deaton, DN; Do, Y; Holt, J; Jeune, MR; Kramer, HF; Larkin, AL; Orband-Miller, LA; Peckham, GE; Poole, C; Price, DJ; Schaller, LT; Shen, Y; Shewchuk, LM; Stewart, EL; Stuart, JD; Thomson, SA; Ward, P; Wilson, JW; Xu, T; Guss, JH; Musetti, C; Rendina, AR; Affleck, K; Anders, D; Hancock, AP; Hobbs, H; Hodgson, ST; Hutchinson, J; Leveridge, MV; Nicholls, H; Smith, IED; Somers, DO; Sneddon, HF; Uddin, S; Cleasby, A; Mortenson, PN; Richardson, C; Saxty, G The discovery of quinoline-3-carboxamides as hematopoietic prostaglandin D synthase (H-PGDS) inhibitors. Bioorg Med Chem27:1456-1478 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM50526515 |
---|
n/a |
---|
Name | BDBM50526515 |
Synonyms: | CHEMBL4476572 |
Type | Small organic molecule |
Emp. Form. | C15H14N4O2 |
Mol. Mass. | 282.2973 |
SMILES | COc1ccc2cc(cnc2c1)C(=O)Nc1cc(C)[nH]n1 |
Structure |
|