Reaction Details |
| Report a problem with these data |
Target | Complement factor D |
---|
Ligand | BDBM50542724 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1987836 (CHEMBL4621383) |
---|
IC50 | 40±n/a nM |
---|
Citation | Lorthiois, E; Roache, J; Barnes-Seeman, D; Altmann, E; Hassiepen, U; Turner, G; Duvadie, R; Hornak, V; Karki, RG; Schiering, N; Weihofen, WA; Perruccio, F; Calhoun, A; Fazal, T; Dedic, D; Durand, C; Dussauge, S; Fettis, K; Tritsch, F; Dentel, C; Druet, A; Liu, D; Kirman, L; Lachal, J; Namoto, K; Bevan, D; Mo, R; Monnet, G; Muller, L; Zessis, R; Huang, X; Lindsley, L; Currie, T; Chiu, YH; Fridrich, C; Delgado, P; Wang, S; Hollis-Symynkywicz, M; Berghausen, J; Williams, E; Liu, H; Liang, G; Kim, H; Hoffmann, P; Hein, A; Ramage, P; D'Arcy, A; Harlfinger, S; Renatus, M; Ruedisser, S; Feldman, D; Elliott, J; Sedrani, R; Maibaum, J; Adams, CM Structure-Based Design and Preclinical Characterization of Selective and Orally Bioavailable Factor XIa Inhibitors: Demonstrating the Power of an Integrated S1 Protease Family Approach. J Med Chem63:8088-8113 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D |
---|
Name: | Complement factor D |
Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
Type: | Protein |
Mol. Mass.: | 27039.19 |
Organism: | Homo sapiens (Human) |
Description: | P00746 |
Residue: | 253 |
Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
BDBM50542724 |
---|
n/a |
---|
Name | BDBM50542724 |
Synonyms: | CHEMBL4636415 |
Type | Small organic molecule |
Emp. Form. | C27H26N2O4 |
Mol. Mass. | 442.5063 |
SMILES | CC(C)(C#N)c1cc(COc2ccccc2CC(O)=O)cc(c1)-c1ccc2OC[C@@H](N)c2c1 |r| |
Structure |
|