| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM13937 |
|---|
| Substrate/Competitor | BDBM12679 |
|---|
| Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
|---|
| pH | 7.7±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 3600±n/a nM |
|---|
| Citation |  Katz, BA; Elrod, K; Luong, C; Rice, MJ; Mackman, RL; Sprengeler, PA; Spencer, J; Hataye, J; Janc, J; Link, J; Litvak, J; Rai, R; Rice, K; Sideris, S; Verner, E; Young, W A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site. J Mol Biol307:1451-86 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM13937 |
|---|
| BDBM12679 |
|---|
| Name | BDBM13937 |
|---|
| Synonyms: | 2-(2-HYDROXY-PHENYL)-1H-BENZOIMIDAZOLE-5-CARBOXAMIDINE | APC-1144 | {amino[2-(2-hydroxyphenyl)-1H-1,3-benzodiazol-5-yl]methylidene}azanium |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H13N4O |
|---|
| Mol. Mass. | 253.2787 |
|---|
| SMILES | NC(=[NH2+])c1ccc2nc([nH]c2c1)-c1ccccc1O |
|---|
| Structure | 
|
|---|
Search and Browse
