| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hematopoietic prostaglandin D synthase |
|---|
| Ligand | BDBM50526495 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1900120 (CHEMBL4402235) |
|---|
| IC50 | 9.7±n/a nM |
|---|
| Citation |  Deaton, DN; Do, Y; Holt, J; Jeune, MR; Kramer, HF; Larkin, AL; Orband-Miller, LA; Peckham, GE; Poole, C; Price, DJ; Schaller, LT; Shen, Y; Shewchuk, LM; Stewart, EL; Stuart, JD; Thomson, SA; Ward, P; Wilson, JW; Xu, T; Guss, JH; Musetti, C; Rendina, AR; Affleck, K; Anders, D; Hancock, AP; Hobbs, H; Hodgson, ST; Hutchinson, J; Leveridge, MV; Nicholls, H; Smith, IED; Somers, DO; Sneddon, HF; Uddin, S; Cleasby, A; Mortenson, PN; Richardson, C; Saxty, G The discovery of quinoline-3-carboxamides as hematopoietic prostaglandin D synthase (H-PGDS) inhibitors. Bioorg Med Chem27:1456-1478 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hematopoietic prostaglandin D synthase |
|---|
| Name: | Hematopoietic prostaglandin D synthase |
|---|
| Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23341.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
|---|
| BDBM50526495 |
|---|
| n/a |
|---|
| Name | BDBM50526495 |
|---|
| Synonyms: | CHEMBL4452633 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20N4O2S |
|---|
| Mol. Mass. | 368.453 |
|---|
| SMILES | COc1ccc2cc(cnc2c1)C(=O)NC1CCN(CC1)c1nccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
