| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM50542739 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1987836 (CHEMBL4621383) |
|---|
| IC50 | 27200±n/a nM |
|---|
| Citation |  Lorthiois, E; Roache, J; Barnes-Seeman, D; Altmann, E; Hassiepen, U; Turner, G; Duvadie, R; Hornak, V; Karki, RG; Schiering, N; Weihofen, WA; Perruccio, F; Calhoun, A; Fazal, T; Dedic, D; Durand, C; Dussauge, S; Fettis, K; Tritsch, F; Dentel, C; Druet, A; Liu, D; Kirman, L; Lachal, J; Namoto, K; Bevan, D; Mo, R; Monnet, G; Muller, L; Zessis, R; Huang, X; Lindsley, L; Currie, T; Chiu, YH; Fridrich, C; Delgado, P; Wang, S; Hollis-Symynkywicz, M; Berghausen, J; Williams, E; Liu, H; Liang, G; Kim, H; Hoffmann, P; Hein, A; Ramage, P; D'Arcy, A; Harlfinger, S; Renatus, M; Ruedisser, S; Feldman, D; Elliott, J; Sedrani, R; Maibaum, J; Adams, CM Structure-Based Design and Preclinical Characterization of Selective and Orally Bioavailable Factor XIa Inhibitors: Demonstrating the Power of an Integrated S1 Protease Family Approach. J Med Chem63:8088-8113 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM50542739 |
|---|
| n/a |
|---|
| Name | BDBM50542739 |
|---|
| Synonyms: | CHEMBL4636760 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H29NO6 |
|---|
| Mol. Mass. | 463.5223 |
|---|
| SMILES | COc1cccc(C(O)=O)c1OCC(O)c1cc(cc(c1)-c1ccc2OC[C@@H](N)c2c1)C(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
