Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-8 |
---|
Ligand | BDBM50277816 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_502029 (CHEMBL981240) |
---|
IC50 | 36±n/a nM |
---|
Citation | Zhou, HJ; Aujay, MA; Bennett, MK; Dajee, M; Demo, SD; Fang, Y; Ho, MN; Jiang, J; Kirk, CJ; Laidig, GJ; Lewis, ER; Lu, Y; Muchamuel, T; Parlati, F; Ring, E; Shenk, KD; Shields, J; Shwonek, PJ; Stanton, T; Sun, CM; Sylvain, C; Woo, TM; Yang, J Design and synthesis of an orally bioavailable and selective peptide epoxyketone proteasome inhibitor (PR-047). J Med Chem52:3028-38 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-8 |
---|
Name: | Proteasome subunit beta type-8 |
Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
Type: | PROTEIN |
Mol. Mass.: | 30357.49 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1446797 |
Residue: | 276 |
Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
BDBM50277816 |
---|
n/a |
---|
Name | BDBM50277816 |
Synonyms: | 3-methoxy-N-((S)-3-methoxy-1-((S)-3-methoxy-1-((S)-1-((R)-2-methyloxiran-2-yl)-1-oxo-3-phenylpropan-2-ylamino)-1-oxopropan-2-ylamino)-1-oxopropan-2-yl)isoxazole-5-carboxamide | CHEMBL483739 |
Type | Small organic molecule |
Emp. Form. | C25H32N4O9 |
Mol. Mass. | 532.543 |
SMILES | COC[C@H](NC(=O)[C@H](COC)NC(=O)c1cc(OC)no1)C(=O)N[C@@H](Cc1ccccc1)C(=O)[C@@]1(C)CO1 |r| |
Structure |
|