| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-8 |
|---|
| Ligand | BDBM50277780 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_502029 (CHEMBL981240) |
|---|
| IC50 | 41±n/a nM |
|---|
| Citation |  Zhou, HJ; Aujay, MA; Bennett, MK; Dajee, M; Demo, SD; Fang, Y; Ho, MN; Jiang, J; Kirk, CJ; Laidig, GJ; Lewis, ER; Lu, Y; Muchamuel, T; Parlati, F; Ring, E; Shenk, KD; Shields, J; Shwonek, PJ; Stanton, T; Sun, CM; Sylvain, C; Woo, TM; Yang, J Design and synthesis of an orally bioavailable and selective peptide epoxyketone proteasome inhibitor (PR-047). J Med Chem52:3028-38 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-8 |
|---|
| Name: | Proteasome subunit beta type-8 |
|---|
| Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30357.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1446797 |
|---|
| Residue: | 276 |
|---|
| Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
|---|
| BDBM50277780 |
|---|
| n/a |
|---|
| Name | BDBM50277780 |
|---|
| Synonyms: | 5-ethoxy-N-((S)-3-methoxy-1-((S)-3-methoxy-1-((S)-4-methyl-1-((R)-2-methyloxiran-2-yl)-1-oxopentan-2-ylamino)-1-oxopropan-2-ylamino)-1-oxopropan-2-yl)isoxazole-3-carboxamide | CHEMBL484004 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H36N4O9 |
|---|
| Mol. Mass. | 512.5533 |
|---|
| SMILES | CCOc1cc(no1)C(=O)N[C@@H](COC)C(=O)N[C@@H](COC)C(=O)N[C@@H](CC(C)C)C(=O)[C@@]1(C)CO1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
