Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 4 |
---|
Ligand | BDBM50150701 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305061 (CHEMBL832693) |
---|
IC50 | 1500±n/a nM |
---|
Citation | Engler, TA; Henry, JR; Malhotra, S; Cunningham, B; Furness, K; Brozinick, J; Burkholder, TP; Clay, MP; Clayton, J; Diefenbacher, C; Hawkins, E; Iversen, PW; Li, Y; Lindstrom, TD; Marquart, AL; McLean, J; Mendel, D; Misener, E; Briere, D; O'Toole, JC; Porter, WJ; Queener, S; Reel, JK; Owens, RA; Brier, RA; Eessalu, TE; Wagner, JR; Campbell, RM; Vaughn, R Substituted 3-imidazo[1,2-a]pyridin-3-yl- 4-(1,2,3,4-tetrahydro-[1,4]diazepino-[6,7,1-hi]indol-7-yl)pyrrole-2,5-diones as highly selective and potent inhibitors of glycogen synthase kinase-3. J Med Chem47:3934-7 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 4 |
---|
Name: | Cyclin-dependent kinase 4 |
Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
Type: | Enzyme Subunit |
Mol. Mass.: | 33731.96 |
Organism: | Homo sapiens (Human) |
Description: | P11802 |
Residue: | 303 |
Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
BDBM50150701 |
---|
n/a |
---|
Name | BDBM50150701 |
Synonyms: | 7-(4-(H-imidazo[1,2-a]pyridin-3-yl)-2,5-dioxo-2,5-dihydro-1H-pyrrol-3-yl)-N,N-dimethyl-3,4-dihydro-[1,4]diazepino[6,7,1-hi]indole-2(1H)-carboxamide | 7-(4-Imidazo[1,2-a]pyridin-3-yl-2,5-dioxo-2,5-dihydro-1H-pyrrol-3-yl)-3,4-dihydro-1H-[1,4]diazepino[6,7,1-hi]indole-2-carboxylic acid dimethylamide | CHEMBL362814 |
Type | Small organic molecule |
Emp. Form. | C25H22N6O3 |
Mol. Mass. | 454.4806 |
SMILES | CN(C)C(=O)N1CCn2cc(C3=C(C(=O)NC3=O)c3cnc4ccccn34)c3cccc(C1)c23 |t:11| |
Structure |
|