Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 3 |
---|
Ligand | BDBM50169441 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1578112 (CHEMBL3807067) |
---|
IC50 | >1000±n/a nM |
---|
Citation | Dhar, TG; Xiao, HY; Xie, J; Lehman-McKeeman, LD; Wu, DR; Dabros, M; Yang, X; Taylor, TL; Zhou, XD; Heimrich, EM; Thomas, R; McIntyre, KW; Warrack, B; Shi, H; Levesque, PC; Zhu, JL; Hennan, J; Balimane, P; Yang, Z; Marino, AM; Cornelius, G; D'Arienzo, CJ; Mathur, A; Shen, DR; Cvijic, ME; Salter-Cid, L; Barrish, JC; Carter, PH; Dyckman, AJ Identification and Preclinical Pharmacology of BMS-986104: A Differentiated S1P1 Receptor Modulator in Clinical Trials. ACS Med Chem Lett7:283-8 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 3 |
---|
Name: | Sphingosine 1-phosphate receptor 3 |
Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42278.13 |
Organism: | Homo sapiens (Human) |
Description: | Q99500 |
Residue: | 378 |
Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
BDBM50169441 |
---|
n/a |
---|
Name | BDBM50169441 |
Synonyms: | CHEMBL3806205 |
Type | Small organic molecule |
Emp. Form. | C22H36NO4P |
Mol. Mass. | 409.4993 |
SMILES | CCCCCC[C@@H]1CCc2cc(ccc2C1)[C@H]1CC[C@](N)(COP(O)(O)=O)C1 |r| |
Structure |
|