| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4 |
|---|
| Ligand | BDBM50179207 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_325229 (CHEMBL861590) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Ho, CY; Ludovici, DW; Maharoof, US; Mei, J; Sechler, JL; Tuman, RW; Strobel, ED; Andraka, L; Yen, HK; Leo, G; Li, J; Almond, H; Lu, H; DeVine, A; Tominovich, RM; Baker, J; Emanuel, S; Gruninger, RH; Middleton, SA; Johnson, DL; Galemmo, RA (6,7-Dimethoxy-2,4-dihydroindeno[1,2-c]pyrazol-3-yl)phenylamines: platelet-derived growth factor receptor tyrosine kinase inhibitors with broad antiproliferative activity against tumor cells. J Med Chem48:8163-73 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4 |
|---|
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33731.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11802 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
|---|
| BDBM50179207 |
|---|
| n/a |
|---|
| Name | BDBM50179207 |
|---|
| Synonyms: | 3-fluoro-N-(6,7-dimethoxy-2,4-dihydroindeno[1,2-c]pyrazol-3-yl)phenylamine | CHEMBL120077 | JNJ-10198409 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16FN3O2 |
|---|
| Mol. Mass. | 325.3369 |
|---|
| SMILES | COc1cc2Cc3c(Nc4cccc(F)c4)[nH]nc3-c2cc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
